PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678401489
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family ZF-HD
Protein Properties Length: 210aa    MW: 23811.8 Da    PI: 8.6006
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678401489genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer98.45.5e-313489359
  ZF-HD_dimer  3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59
                 +++Y+eC+kNhAa++Gg+++DGCgEfmp+ geegt +alkCaAC+CHRnFHR++++ 
    678401489 34 GITYRECRKNHAANIGGNVTDGCGEFMPT-GEEGTLEALKCAACNCHRNFHRKQHHG 89
                 689*************************8.999********************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257743.0E-203590IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047702.3E-283587IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015661.1E-293686IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152326.0483786IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466895.7E-18132199IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.0E-30136201IPR009057Homeodomain-like
TIGRFAMsTIGR015652.3E-29141198IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 210 aa     Download sequence    Send to blast
MSESEVRMQS GYNYAAVENQ SEKPRMLNFG DGRGITYREC RKNHAANIGG NVTDGCGEFM  60
PTGEEGTLEA LKCAACNCHR NFHRKQHHGE AMPVVHPLHL RPHWTQMVQP VKVVYGGGTD  120
SSSEELNFNP GAPPPPDFAS KKRFRTKFTA AQKEKMQEFA EKLGWRIPRD DDSEIQRFCA  180
EVGVKRQVFK VWMHNNKNTS TSKKTPPEEF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A4e-251402021678ZF-HD homeobox family protein
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00268DAPTransfer from AT2G18350Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011083674.11e-89PREDICTED: zinc-finger homeodomain protein 5
SwissprotQ9ZPW79e-58ZHD6_ARATH; Zinc-finger homeodomain protein 6
TrEMBLS8C3821e-89S8C382_9LAMI; Uncharacterized protein (Fragment)
STRINGPGSC0003DMT4000095813e-70(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA51824128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G18350.15e-59homeobox protein 24